DPCstruct | MC51373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 17.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7E6L5 | 4-133 | EIKDRYGNYKQDCFLLPSGGCKCSERDEVGNEVVKKYDDGAHCKFSQKNKRTANEQPPQNARDPIRERAQANYRAVINELNEKFKGL… |
| A0A077Z7U0 | 200-299 | EVQEELMERVRGYRRRCYPMPVDGCRCDEILGSKRYATDEECRRKGPSTKERNAKAEVQEELMERVKGYRRKCYPMPVDGCRCDEIL… |
| A0A0N5AR73 | 55-162 | None |
| A0A085MMG6 | 241-394 | None |
| A0A0B2VEZ4 | 328-466 | None |
| A0A158Q905 | 55-194 | None |
| A0A5S6QIW1 | 67-200 | None |
| A0A3P7ZW18 | 11-153 | None |
| A0A2A2M0B8 | 28-138 | None |
| A0A1I7S315 | 202-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.