DPCstruct | MC5137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 135 ± 30 aa |
| Standard deviation of domain lengths | 29.59 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.73 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0172- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V1EFD0 | 4-135 | FFTRMNSYDIYESLESIHVFALAHVLKRPIVIVSDTVLRDISGEALSPIMFGGIYLPLECSPSECHRSPLVLCFDTAHFSALVAMQK… |
| A0A7S1A993 | 362-459 | LDSVHVLAVAHALCRPLVVVAPAMQTDHFGVPLTPLFFRGIYLPFECPPELCCQQPLILCFKDAHFMPVVPVRGAATQVRVPLADGT… |
| A0A4W3H451 | 152-272 | None |
| A0A812DGL3 | 77-214 | None |
| A0A183HMZ4 | 3-178 | None |
| A0A5E4PXZ1 | 1-106 | None |
| A0A368F850 | 166-295 | None |
| C3ZYU6 | 22-146 | None |
| A0A2G8L400 | 298-418 | None |
| A0A821F3P3 | 341-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.