DPCstruct | MC51368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 219 ± 44 aa |
| Standard deviation of domain lengths | 43.81 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7DX27 | 2-206 | KSILPPITFAQLTSIHQDQSLTVQQKIMKIDEILNALPEDILQRLPLPPVFRLLPQEIQEMIKIVRTAKNLTMQEKWLQMTILIESL… |
| A0A0N5BL71 | 7-163 | VPPPNKELEAIVGPDVFSKINQIHQSTDTPKVKLQKVDELFASLSDDVLKKIPIPKHLMGLPEDAKKEVHSIMVDKKLTALEKYEKT… |
| A0A6V7U6G9 | 112-364 | None |
| A0A4U8URI7 | 27-204 | None |
| A0A0B1T6J0 | 17-184 | None |
| A0A6V7X4Q1 | 18-244 | None |
| A0A6V7WFV5 | 10-290 | None |
| A0A0M3ICG3 | 31-280 | None |
| A0A2K6WAG1 | 62-224 | None |
| A0A7E4WB69 | 43-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.