DPCstruct | MC51364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 183 ± 37 aa |
| Standard deviation of domain lengths | 37.42 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4MN02 | 25-214 | NCSRPISRRVSHSIRQLLKNERGISKYLRPECAFNQENHIFNHEESIKIVYPTGERQCGFCGEIFQEEKTYDQHMEKFHSHPQSGEF… |
| A0A210QLZ2 | 23-200 | VAGNRCSKSLSRIVRQQVKERLLPHYEEFKMKMPDSCPLSPNRDVYMMQEEKVFIESSSRYKCNVCGKAFISQFYIDMHFDNRHPDY… |
| A0A4Y1R8I6 | 1-177 | None |
| A0A059AH62 | 2-180 | None |
| A0A059A678 | 50-215 | None |
| A0A5B6YJI0 | 34-206 | None |
| A0A0V0J8A1 | 2-173 | None |
| A0A7R9Q6I3 | 347-540 | None |
| R7QED4 | 14-242 | None |
| A0A183NX95 | 80-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.