DPCstruct | MC51360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 82 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4KBM1 | 1-92 | MRRESATSPFNENGWLAPRAREKSYRIIPGDQIGNPEVRRLMTSDGSTLSDWGKYTTLTHQSPYGDFQVHYYYNPATGRMLNYDYKV… |
| A0A066U378 | 517-600 | PFTPDGKLTAVAVEEAFPVQAGEVIGNPYVKEVFARSGGPSQWAKYSTRTHHSPYGDFQIHFYHNRTTGEVYYGHDYKVVMNRR |
| A0A059E5V3 | 124-194 | None |
| E4WLC8 | 93-162 | None |
| A0A1I9ZHX8 | 700-801 | None |
| F2JKK4 | 113-179 | None |
| A0A355F9S5 | 3-75 | None |
| A0A4V1EI35 | 263-338 | None |
| A0A848M264 | 50-136 | None |
| A0A6L9ZMF6 | 14-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.