DPCstruct | MC51354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 106 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8XJI8 | 1-102 | MGFGTLWRSAEERWAGERGLLYGHLHIHLLFPTLVVTGKDGREYTVIRNGRLTALADPEVRALAARFGDPDELLKEDWIPQIPGITG… |
| A0A1F9FD05 | 323-423 | GTLWRAPEEKWAGERGLLYGHLHIHLLLPTLTVTARDGREHVVIREGRLTALDDPGVRKLAATYGDPDELLKEDWIPQIPGITSAGS… |
| A0A2V9HM29 | 1-114 | None |
| A0A536I5Q9 | 685-797 | None |
| A0A0U2M0Y2 | 357-456 | None |
| A0A521SRJ2 | 451-557 | None |
| A0A7V9GZB7 | 364-462 | None |
| A0A534SVJ5 | 143-242 | None |
| A0A7V8XQV4 | 314-420 | None |
| A0A534UWT3 | 212-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.