DPCstruct | MC51342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 302 |
|---|---|
| Mean domain length (aa) | 222 ± 52 aa |
| Standard deviation of domain lengths | 52.23 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 73.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04195 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484N687 | 12-242 | GPSIIKENELREVAMLLGKGFRVHHPDAIGGISLSHNPNPQKYMVMQYHSVENGFRLPLHGLLRGLCLHFGFAPGQLTTNAHKYVAS… |
| A0A2K3M023 | 52-241 | VEDIRNGPVNWETHLPEEGERICSTFPKDGFAMYELAFKEMGFRLPFSNFECEVFGRLKVAPSQLHPNSMAFIRAYPILCRYLNVEA… |
| A0A0D3DKF6 | 49-270 | None |
| A0A396I3K3 | 81-218 | None |
| A0A396HYZ1 | 1-272 | None |
| A0A396HYA1 | 19-274 | None |
| A0A396H1N3 | 9-203 | None |
| A0A5N6P3J7 | 1-265 | None |
| A0A1U7Y213 | 2-206 | None |
| A0A194YGX4 | 14-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.