DPCstruct | MC51341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 318 ± 31 aa |
| Standard deviation of domain lengths | 30.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484N4Y1 | 1-299 | MPVLAPFTLAGPMELWIQDGKNMRLSLPHDVEAGTVKKVVLADGAMVTVKGARSVSLRHPVEFPLPFNTSHNGFASGLLTLAEHLRQ… |
| A0A1U7VXC0 | 136-408 | ATLDVLKIQGPFELYATGDDDYLSLNLPLNSSYTGLKRILVGEGITVEVKGADKISIFNISALLKLVNGSILTKSGGCEFGYVWQSS… |
| A0A6A6NH44 | 150-460 | None |
| A0A7S0R3D0 | 1-375 | None |
| A0A834XES7 | 266-589 | None |
| A0A2I0HM32 | 705-1023 | None |
| A0A7S2QU91 | 114-471 | None |
| A0A7J8NW59 | 205-524 | None |
| A0A835QE47 | 92-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.