DPCstruct | MC5131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2YGP3 | 2-121 | YSSIAQANEAIIERIKAARPHWVAVRPAKDAVAELASGRKLLHAGPPIDWEEMTGPMRGACIGASLFEGWAASEEEAVRMLEQGEVA… |
| A0A6D0F3I5 | 1-126 | MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNQGKTLLHAGPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAMLEQGEV… |
| A0A2V6TAC4 | 566-689 | None |
| A0A6M5Z8P4 | 13-115 | None |
| A0A0M0K0G8 | 626-775 | None |
| A0A6L8W9M2 | 158-304 | None |
| A0A354U761 | 1-112 | None |
| A0A1Q8JC87 | 441-571 | None |
| A0A8B5W7B0 | 308-431 | None |
| A0A6G1YLZ3 | 9-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.