DPCstruct | MC51304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 155 ± 25 aa |
| Standard deviation of domain lengths | 24.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6I0F5 | 2-137 | FSILILPGACVFLYGRMIGNIRHAWVIFSVMFTVFCVGVITVWFFESSYNPLWRSYGFWEGKEVRFGILNSAIWEVATTVASNGSVN… |
| A0A6N8Q8C2 | 103-245 | FFNANSSHPFENPTALTNFVQMLAIFLIPTALCFAFGEVTGDRRQGRMLLWAMSVIFVICVGVVMWAEVQGNPHLLALGTDSSINME… |
| A0A6G3V984 | 2-132 | None |
| A0A1L8ZGU2 | 9-150 | None |
| A0A1E1VVB2 | 2-174 | None |
| A0A447XBT0 | 2-114 | None |
| A0A377GL00 | 276-445 | None |
| A0A1I7Y2R5 | 28-224 | None |
| A0A1V4TRG9 | 476-644 | None |
| A0A376W1S7 | 60-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.