DPCstruct | MC513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 168 ± 48 aa |
| Standard deviation of domain lengths | 47.50 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 82.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1CB67 | 28-164 | DKQSEIVTQALERAFPSYILTMIKVMMPPSRFSREYFAAFTTIFFPWLVGPCEVMESEVDGRKEKNVVYIPKCRFLESTNCVGMCTN… |
| A0A803NPS1 | 3-95 | RCNVNSVDLGDGSSCNSGVFVEKCKYLEESKCVGICINTCKLPTQTFFKDYMGVPLLMEPNFSDYSCQFKFGVHPPLAEDDAILKEP… |
| C1E928 | 168-362 | None |
| A0A7I4DYF2 | 75-172 | None |
| A0A1E7FNX2 | 17-129 | None |
| A0A2U1QNF5 | 69-280 | None |
| A0A0E0H8Z3 | 259-528 | None |
| A0A1X6PGA1 | 10-179 | None |
| A0A7S1Z6N4 | 92-305 | None |
| A0A7S0ALD1 | 46-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.