DPCstruct | MC51299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Standard deviation of domain lengths | 12.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7NAY0 | 1-78 | MRFEWDESKNKVNISKHGIDFNDVPDIFRHPMLALRDDRADYGEERWICIGWIKRLMGVVVYTERCGDVIRIISARKA |
| A0A853HQC6 | 1-90 | MTGLEFDPAKNAVNLRKHGVPPALGVDALADPNLIEREDRSMDCGEVRCTALGMVAGTVHVVVFTKRADRIRFISVRPADRHETDHY… |
| A0A3B0YUK0 | 4-93 | None |
| A0A2W7BM49 | 2-78 | None |
| A0A6G4WE42 | 14-107 | None |
| A0A6B2M5R4 | 4-75 | None |
| A0A7W6MAS0 | 16-106 | None |
| A0A1F6HXA2 | 19-112 | None |
| A0A6L5F1H7 | 16-114 | None |
| A0A1D2RQ03 | 12-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.