DPCstruct | MC51298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D5NP96 | 2-82 | QFYLAKLGKSLGYNVWIARNDHKRAWEDQILGEWSLKNLKLENISDTVLDTVSLIDVLWLDQDNNIVSGFEVEKSTSIYHK |
| A0A3B1AZ99 | 76-155 | QYHLLKIGQSLGYDVISASNDRSRCHDGNSFTFISLSDFPEIDVDKDTEKTIQLIDVVWFEKDTNKIVSAFEVEKSTSIY |
| A0A840XYG2 | 261-340 | None |
| A0A822IWN2 | 1-69 | None |
| A0A132HG24 | 143-221 | None |
| A0A142XBF0 | 132-197 | None |
| A0A3S0P1M3 | 72-156 | None |
| A0A327LVV4 | 124-207 | None |
| A0A3C1A2T1 | 233-310 | None |
| A0A1Q3HQJ7 | 127-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.