DPCstruct | MC51275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0N4R9 | 1-69 | MKIVHPPCGREWSGQRAEHCPACHETFAGTRAGDAHRTGPHDARRCVPPATAGLWQDARGLWHRAPYRD |
| A0A7Y5XKQ3 | 68-133 | AIVHGTCGRWWTGNERSHCGGCHELYSSLTAFDRHRRGGQCLPPESVGLVAREKPYGVLWGFPAPE |
| A0A1G8EIY4 | 10-74 | None |
| A0A6B2VL78 | 9-75 | None |
| A0A7Y0QQN6 | 1-72 | None |
| A0A2A3ZCN8 | 85-160 | None |
| A0A0B7NQE5 | 4-81 | None |
| A0A7T7L2B1 | 169-236 | None |
| A0A7W5P5K9 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.