DPCstruct | MC51270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1Z2I4 | 1-78 | MAEICDVCGEPLDEDNVSRCLICGGKFHMAWSIDAPVKNCGQAWFDERYCSLGFICTPCINENPQLRRSLIETGGTLP |
| A0A5J6T1N5 | 3-65 | TQEPKRCHVCALEVEAHMEAWCNWCGNLYHLNSRADLPGTDCGQVWINEEHLALEFACNVCLA |
| A0A6I1QGL1 | 3-70 | None |
| A0A2W0ZXI1 | 3-68 | None |
| A0A521WNN5 | 1-75 | None |
| A0A3L7XR00 | 7-69 | None |
| A0A7V2PG11 | 1-64 | None |
| A0A6L7PX52 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.