DPCstruct | MC5127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 167 ± 11 aa |
| Standard deviation of domain lengths | 10.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S6EXR8 | 229-415 | PCLSVDDRARLFSLLWGEIPALTAAYRHFAHTLQHLNGATVVLAPLSVLVDDLQLPANGLMNMTTLANLNAPSDISVQVRPLCQGEK… |
| A0A2X2W921 | 1-160 | MDLTTRASAWALLWGEQPELTQQWLTLARTLQQTGHAQELAAPLSLLVDHFGLPAESFLTQGALSGNDAQSDVVVHPVEHHQLLNAV… |
| A0A379WTK1 | 97-255 | None |
| A0A447U308 | 4-166 | None |
| A0A6D0M2A3 | 1-150 | None |
| A0A5B0SU37 | 32-205 | None |
| A0A4U9VWV2 | 42-196 | None |
| A0A4U9HVZ0 | 14-177 | None |
| A0A377TCG0 | 96-271 | None |
| A0A143HUP1 | 189-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.