DPCstruct | MC51261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 160 ± 28 aa |
| Standard deviation of domain lengths | 28.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6C532 | 1-126 | MTTEYENEKKRFTERYLSRDTKDQQGGRTEEIRMTPLCSLAVAHTATQSVLPQYGLLGFHAGQSEEISEKEPILLNINAPNSTFICG… |
| A0A066XPQ6 | 98-248 | LDSTTSEDENTVDEEENNLDEITIQMEHLGFDAAVQHQDEVLSSPLITVPLLRASPPLQFGLFGGSVSQSCPLSQASRLFYNVTCPS… |
| A0A0D8JV07 | 1-131 | None |
| A0A4Z1NX25 | 1-194 | None |
| A0A4R8TN16 | 2-158 | None |
| A0A1Y2DB80 | 6-180 | None |
| A0A2U3DPD5 | 389-600 | None |
| A0A7R8A0E0 | 2-166 | None |
| A0A0J6YEK7 | 35-211 | None |
| A0A6A5SMV8 | 86-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.