DPCstruct | MC5126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 62.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447N8B8 | 135-252 | VSSAFDFADIANVINASMRAGYQITGVILQRDDGVLVSNRLEKSLPIVDEVLYIDRIPLGMLAAIEVAVPGKVIETLSNPYGIATVF… |
| A0A378EEH1 | 38-155 | VSSAFDFADVAAIVNAATAAGYQITGIILQQDDGVLVNNRLQQPLPVIDEVQHIDRIPLGMLAAVEVALPGKIIETLSNPYGIATVF… |
| A0A7Z1APT6 | 146-292 | None |
| A0A2X2RK60 | 61-177 | None |
| A0A7H4MRL3 | 52-168 | None |
| A0A6N6XBG7 | 63-180 | None |
| E4LFR0 | 136-252 | None |
| F0JQ29 | 135-252 | None |
| A0A1G7WYC3 | 82-198 | None |
| A0A2X3D3F9 | 51-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.