DPCstruct | MC51254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 160 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6WP21 | 1-161 | MLPMDDDFNSSDVDFGPEPAGRFDDAGAASIKGILESAFADRLRSKKGTKHLQKTYASPKTEYQATLWINRFTAFREHTLRVSPDEC… |
| A0A066WZS2 | 1-145 | MAQTEANAAMNAMVSNADALRLEIRRRSKTFQPTSLSPSMNELLAHWKVRFDRFRHEILKKSPSETPTGEDVEACFWVMHRYMEKNG… |
| A0A094E5M7 | 1-165 | None |
| A0A2V1DRB2 | 1-166 | None |
| A0A094AF65 | 2-164 | None |
| A0A5B0ND39 | 10-162 | None |
| A0A507B229 | 1-169 | None |
| A0A094AMF9 | 2-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.