DPCstruct | MC51252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 598 ± 137 aa |
| Standard deviation of domain lengths | 137.10 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.24 |
| Pfam Score | 99.19 |
| Assigned Pfam label(s) | CL0036- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0LMM2 | 10-601 | VILAAESFSGLGVITSDVYVDNDVTWYLNQNNFLRSVRNFVIDVRPTPQWAYVCGGFMSDLVFVGGNFGVYFGNQQFTTSGLLFDSC… |
| A0A561MZ59 | 51-614 | FYSAMSNIDFEIGKGNPAATAIRFHAAQHAYLSHMDFDIGSGLAGLYQVGNMAEDLHFKGGRYGILAEKTSPAWGFVLLDSTFEGQR… |
| U7Q190 | 219-971 | None |
| U7PQ26 | 625-1293 | None |
| A0A165V1X1 | 8-400 | None |
| J3PE45 | 36-863 | None |
| A0A5N5PDK6 | 91-668 | None |
| A0A1Z5SVZ4 | 24-577 | None |
| A0A2T4BSJ8 | 55-452 | None |
| B0XST0 | 130-793 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.