DPCstruct | MC5125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 11.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484X082 | 4-83 | EKLTDPLMFAAAMVSAGKADVCIAGNLSSTANVLRAGLRIIGLQPGCKTLSSIFLMLPQYSGPALGFADCSVVPQPTAAQ |
| A0A2X2VKC0 | 14-109 | RKSKGMTETVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTANTIRPPLQLIKTAPGSSLVSSVFFMLLPEQVYVYGDCAINPDPT… |
| A0A6D0LWZ5 | 85-200 | None |
| A0A510Y7Y1 | 80-194 | None |
| S7HS51 | 89-193 | None |
| A0A256WCL2 | 517-613 | None |
| T5D8U1 | 272-391 | None |
| A0A381G9W0 | 405-502 | None |
| A0A832GTM0 | 6-102 | None |
| A0A379VMX6 | 28-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.