DPCstruct | MC51248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 96 ± 23 aa |
| Standard deviation of domain lengths | 22.66 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0081- CL0469 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522GFR6 | 2-90 | RLTDRQCAACTPNAREYLWGDDGGLSLRIRPAGSKGWAFRYRDVAGKGVKLGLGAYPRVGLAEARKKANDKREALASWAAYKETEAA… |
| A0A077PF98 | 2-69 | KLTDLAIKRAKPKEKTYTLADGNGLSLLIDTNGSKGWRYRYQFAGKTKMISLGIYPVVTLNEARTQGA |
| A0A7D5STN0 | 5-60 | None |
| C3X6A0 | 2-102 | None |
| A0A1Y5GLK2 | 9-92 | None |
| A0A2Z5UDQ5 | 2-98 | None |
| A0A1V8P534 | 3-96 | None |
| A0A2H5F3C3 | 1-116 | None |
| A0A450SXZ8 | 2-79 | None |
| A0A376F9Z5 | 5-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.