DPCstruct | MC51244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 180 ± 41 aa |
| Standard deviation of domain lengths | 40.71 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.16 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0660- PF06386 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9X8A7 | 38-210 | SRHAALHLSVAAELVFAHERVVEAMLARGSVLPLRFGTRLDSEERLARELAQRRDELVDGLRRVRGRVEVGVRILRERSHPADAEDR… |
| X7ELB4 | 2-185 | QNDELIALLAADALPTVPHGTTAASAGGFVGIFGPAAPRFSSRAKVAADAARRMAWLEALMPAGALLPAMPGTQLAHDELPGMVEAN… |
| A0A538IIL0 | 2-105 | None |
| A0A1V4VA42 | 53-246 | None |
| A0A367ZJM1 | 250-441 | None |
| A0A7W1C3V7 | 4-130 | None |
| A0A3D5DI69 | 50-246 | None |
| A0A1W2EE51 | 1-168 | None |
| A0A147JSJ0 | 219-413 | None |
| A0A2V7EEG5 | 4-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.