DPCstruct | MC51239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7I6G0 | 6-68 | TVDAPAVRWRVSSRTAGNGACVEVAALDRTIAVRDSKDRTGPVLAFTERDWASFIDGIKAGRF |
| A0A7Y6ADN9 | 13-80 | ELYARDISAAEWISYGEDTTGEGVVQTAEIGGGAVAMRNSAHPEGPILRFTKGEWDAFVLGVKDGEFD |
| S3B2X8 | 111-170 | None |
| A0A542XK30 | 55-114 | None |
| A0A2N0GW33 | 156-226 | None |
| A0A2G7D4T3 | 9-61 | None |
| A0A286DTQ8 | 6-85 | None |
| A0A2A2CZ64 | 9-73 | None |
| D9WXU2 | 67-122 | None |
| A0A1W2E7T2 | 23-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.