DPCstruct | MC51237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 156 ± 35 aa |
| Standard deviation of domain lengths | 35.17 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 84.14 |
| Assigned Pfam label(s) | CL0070- PF02308- PF16316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9A659 | 3-144 | GELALRLVFAVIIGGLIGSERHLYNKPAGARTHSLVSLASALFMIISVYGFSGGNWDPARLAAQVISGMGFIGAGVIWKEGFNVKGL… |
| A0A7C5C2B3 | 3-114 | YQLILSLIMGGLLGLERELKGKPAGLQTYSLVALASCLFEILGLGSFVPVGIGFLGAGVISKKEENIFGLTTAAGLWLASAIGVAIG… |
| A0A1V2YL03 | 15-157 | None |
| A0A7S1XFK0 | 74-216 | None |
| A0A838PRK1 | 29-144 | None |
| A0A7C1B3R4 | 3-139 | None |
| A0A1V6P9Y9 | 10-167 | None |
| A0A7U2YJL9 | 1-118 | None |
| A0A7S4SBK3 | 131-232 | None |
| A0A1M4S6G2 | 8-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.