DPCstruct | MC5123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 14.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9INA5 | 23-155 | VAGRPGGAVTLGVGMTFIFSKIPFLAKLGAYIYHFVVLFEALFILTTIDAGTRVGRYLLQEAGGLIYKPLKNTNWWPGIIFTSFLIS… |
| A0A2X2VBZ6 | 3-113 | AFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPANLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIAN… |
| A0A0V8D463 | 113-258 | None |
| A0A4Y9JEJ6 | 19-143 | None |
| A0A1G0WFX0 | 1-119 | None |
| A0A645HVK7 | 2-99 | None |
| A0A7V9JGY1 | 7-139 | None |
| A0A848QD36 | 8-142 | None |
| A0A379SJH5 | 4-114 | None |
| A0A7V8HLC7 | 44-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.