DPCstruct | MC51229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 173 |
|---|---|
| Mean domain length (aa) | 179 ± 22 aa |
| Standard deviation of domain lengths | 22.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2PSL5 | 132-310 | GVIMNRRISPAMIALVALLIALTTVFTIVSKFPIPRTAGGYFNLSDVAIVFASLTFGPWVGLAAGGVGAALGDIFLGAPQFAPLSLV… |
| A0A2A5S3K1 | 2-155 | AIIAALAMAMSLIPLTVGWFEISLGTLLIVLISLRHDTGIGIITGLIWGLLHFVLGKVYFLSVPQVIIEYVLAFSFAGFAGLVANKF… |
| A0A7D7G2U6 | 3-171 | None |
| A0A496SHW6 | 19-207 | None |
| A0A7C1GBB8 | 110-313 | None |
| S6A5S4 | 1-169 | None |
| A0A1I6KDB1 | 35-216 | None |
| A0A2S5RCZ6 | 22-184 | None |
| E6Z0V0 | 3-136 | None |
| R6RCK3 | 183-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.