DPCstruct | MC51226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 14.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.91 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06658 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2M5U0 | 45-188 | TKEVVVCNTVTDIQRRKIDKLMSDPTKEPYIPEPRKEWKPREPAEFVRHVMGSSAGAGSGEFHVYRGIRRREARRNEYLDKKGLKDE… |
| A0A0K0CT91 | 14-138 | AHTATDLIRMRLERLQQNIQKPAPIPARRAELKPPRPPPEFVRNVVGSSAAAGSAEYHIYRINRKKEQNRLDYIAKVAEKEELDEEY… |
| A0A7M5WKH8 | 64-213 | None |
| A0A4U5N477 | 14-151 | None |
| A0A068YJG7 | 6-180 | None |
| A0A0B2VH21 | 53-188 | None |
| Q5ZKU0 | 19-189 | None |
| A0A044UQ54 | 2-139 | None |
| A0A151N5B2 | 1-126 | None |
| K7FUX1 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.