DPCstruct | MC51225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 283 ± 33 aa |
| Standard deviation of domain lengths | 33.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03538 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1WZA9 | 43-346 | NDTVQAAPIPERSAVARDALLAFNQQLTRLGFTSVFEVVRRGRTQVVAHLLQQPALGLQHHQAVDFYEQAQSRAASLTRLYAQLCAR… |
| A0A0L0LZ72 | 4-291 | TDEILDKLNAGNKTNSNLKAGVGDQITLPDIMVRSFAEVKELAGDALTWGEKNFLYRQAQEELKENKMVESRILSRANPQLANAVRL… |
| A0A285Z499 | 6-278 | None |
| A0A1X1DCX8 | 7-293 | None |
| A0A2V7HGE8 | 396-688 | None |
| A0A5C4RN11 | 3-248 | None |
| A0A1V3XSI5 | 383-661 | None |
| A0A6G1W5D0 | 3-343 | None |
| A0A6G6ETA1 | 56-377 | None |
| A0A1H0MPB9 | 16-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.