DPCstruct | MC5122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 4.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 73.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1F1E3 | 89-157 | MAMALVDRALQAPEYGEHATGPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQAELELLKRLQQEQNH |
| A0A6G3HQ85 | 131-199 | MAMALVDRALQAPEYGEHATGPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQAELELLKRLQQEQNH |
| A0A3M3P0P6 | 240-302 | None |
| A0A800BYZ6 | 2-72 | None |
| A0A376X6C5 | 479-545 | None |
| A0A0N8KLX8 | 296-369 | None |
| A0A377DCV3 | 90-156 | None |
| A0A2A3VTK0 | 253-322 | None |
| A0A6Y1RN60 | 138-211 | None |
| A0A418W9G5 | 290-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.