DPCstruct | MC51218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 195 ± 43 aa |
| Standard deviation of domain lengths | 43.46 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6VPY4 | 35-184 | LSEPLHELPSLVEAGGRLQRLIAEFEHWLQWVQDIRSARQNCAGDKKALGTIEGLGDSWKAENAALTRKLTGFARDLERSATPSPGS… |
| A0A0B2WQF4 | 822-1011 | ERERLAVESDNILALRRWARSGRCGVEERTRWLGEIFTGLWTLGEPAGRHARVVKRFERWAARVCDAEEARRDAGSAAVLHGHDSLF… |
| A0A1Y2DWA2 | 7-173 | None |
| A0A420Y300 | 323-530 | None |
| A0A5M3YTD9 | 514-709 | None |
| J3NKU2 | 3-147 | None |
| C4JVZ5 | 84-287 | None |
| N1Q522 | 29-209 | None |
| A0A2V5H522 | 272-521 | None |
| A0A423W4I7 | 903-1089 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.