DPCstruct | MC51207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 283 ± 52 aa |
| Standard deviation of domain lengths | 52.34 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.14 |
| Pfam Score | 99.04 |
| Assigned Pfam label(s) | PF19272- CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9YAF6 | 16-226 | LDPVRDHHEIYRLSAGYEFPFDYQRALELALLRTFCVPGISALLDATGEFRLRAQQRYDDTALLMAELLEHGYDSPRGREALRVVNR… |
| A0A2E8PW21 | 45-371 | DSVIEKLLSSGRIDGLHSILDAIQRNGDAVPDCPPVLRSYFEETARLPSFANQDTLSHSQDVFARYGLPMTLSLFCLVLPEGYAAPR… |
| A0A1S8VZS5 | 3-261 | None |
| A0A4Q7KY34 | 345-618 | None |
| A0A6G3VKQ7 | 2-213 | None |
| A0A4Y4C0V9 | 2-256 | None |
| A0A2H3BQ41 | 6-263 | None |
| A0A0K9XIV2 | 11-252 | None |
| C4JTY3 | 2-201 | None |
| A0A4Y8CDD6 | 166-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.