DPCstruct | MC5120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 152 ± 23 aa |
| Standard deviation of domain lengths | 23.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18864 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D2KW06 | 8-171 | ILGDLKVSQVLYYVIANYQYNLDKELVEWAECECNGYPNPCVLPDYRYIDCKVYARYVDNFGNEHDEQIDVNSIDNYLRKHGDENAL… |
| A0A7V7K155 | 64-224 | NARTLSQEAKWLKSNIHEAKLSESLPRALQFSKSIDNKKLERWIRLELYGYNKDGGMTDNDFVPEYRAVTGRWVDQFNQMLDITHYS… |
| A0A317IIW2 | 24-208 | None |
| A0A7D5UKE2 | 4-131 | None |
| A0A7J9PNV8 | 4-159 | None |
| A0A4R1KFA7 | 16-184 | None |
| A0A7D5ESE2 | 2-157 | None |
| A0A498AKV4 | 4-191 | None |
| A0A644XTS5 | 210-385 | None |
| A0A3A9ZIM5 | 71-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.