DPCstruct | MC512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 142 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 73.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 76.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7B554 | 1-133 | MSTKKENADAAAAAADRIKAAALSAAKGLSRAQAERAAAAAARNVNAYGQKEEGPSRWQERKEAKRQMYLMSTEKAVKLGVRKDPRS… |
| A0A6G1C580 | 1-146 | MSGNDDKSQAAADRIKAAALSAAKGMSRAQAERAATAAARNLNAYGQKEEGPSRWQERKEAKRQMYLMSTEKAAAILGVKPKASATS… |
| A0A4S8JMY6 | 47-201 | None |
| A0A3L6G3H8 | 1-130 | None |
| A0A445AWN1 | 2-142 | None |
| A0A4D9A968 | 1-144 | None |
| A0A816KHZ9 | 1-144 | None |
| A0A822YP87 | 1-145 | None |
| A0A2U1NXW2 | 1-144 | None |
| A0A2R6W2T6 | 4-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.