DPCstruct | MC51195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 14 aa |
| Standard deviation of domain lengths | 13.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 57.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060BT14 | 1-88 | MVSAWGGYVFITNLIPLHVFVLIFMGRYNPKLYTAYTTWYALGTLASMQIPFVGFLPIRSNDHMAALGVFGLLQLVALGDYVRSKVPS |
| A0A0R3SM85 | 58-135 | MVSAWGGYVFIINLVPLHAFVLCLTGRYSSRLYVAYTSFYILGLILSMQVPFVGFQPVRTSEHMAAAGVFVLLQVIFI |
| A0A4W6C7Z3 | 149-231 | None |
| A0A7J6SI50 | 74-175 | None |
| A0A453FF24 | 1-93 | None |
| A0A5C6NFD7 | 113-179 | None |
| Q6F2Z1 | 211-323 | None |
| A0A2P2LZQ4 | 1-73 | None |
| A0A446NMT6 | 60-152 | None |
| U1FUJ8 | 458-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.