DPCstruct | MC51193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 134 ± 19 aa |
| Standard deviation of domain lengths | 19.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354I2Y8 | 74-187 | SSFDDHSGGKENLTKVTDSVVDRGRSYRGLNFFAERDLQVLEVISRGEYMTFGMQGKDIRQHLENISPSAMSRIFKRLRLHGIIERV… |
| A0A6L7WRQ8 | 3-126 | RPAHIDGQRASTLRFGDPRVQALLAALLRFDLLPAGFRNRELREAVAPLRGMSLDDYNAGQMTYDLRRLRLRGLIERIPHTQRYRLT… |
| A0A3D5DYQ3 | 79-233 | None |
| A0A843RY25 | 300-434 | None |
| A0A6N6S7M3 | 173-280 | None |
| A0A498P698 | 51-204 | None |
| A0A7Y8M019 | 206-337 | None |
| A0A2V8Z351 | 30-165 | None |
| A0A7V0UIU3 | 152-274 | None |
| A0A080M6B3 | 111-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.