DPCstruct | MC51192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7WRG0 | 1-89 | MTTHSDYLIKELNNLIMLSRSFRNKSKVTRKLKYARDDYIVPERIRAYVAANGGIAKCEIDKLGIDMPNFDETINEINDVANELAIR… |
| A0A1H6MYD8 | 138-225 | TTHSDTLVLEINNLIMLSNEFDDKDSFMKKHKYQQVHIINPEKVSTYIAKDGGVSECTIDQYGIEVESMDKAIDNLNTIRDGLEARIN |
| A0A836SD25 | 225-312 | None |
| A0A2J0QRA0 | 62-154 | None |
| A0A496V262 | 4-81 | None |
| A0A833EDL5 | 130-215 | None |
| A0A4U9KCR0 | 3-98 | None |
| A0A101XG25 | 371-454 | None |
| A0A3M1TSN1 | 125-215 | None |
| A0A497G8Q9 | 56-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.