DPCstruct | MC51187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M4F2R7 | 1-102 | LYRTPIYMLNRIIQLQAVLEVITNQTATALEFLARQSSQMREAIYQNRMALDYLLAEDGGVCGKFNLSNCCLQIDDNEKVVLKIAKE… |
| A0A3M0J2T6 | 21-141 | KWKGKIWTPEEIIKTYGPATWAQDGSWGYRTPIYMLNRIIRLQAVLEMVSNRTALALDHISDQLTQTRAVIYQIRLAVDYLLADEGG… |
| A0A670IPT2 | 1-118 | None |
| A0A3M0L9J4 | 43-146 | None |
| A0A3M0LGA9 | 68-168 | None |
| A0A3M0ITW2 | 154-272 | None |
| A0A3M0IXU0 | 41-161 | None |
| A0A3L8Q7P9 | 112-215 | None |
| A0A3M0J9T6 | 211-329 | None |
| A0A3M0JCK1 | 527-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.