DPCstruct | MC51180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 79.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T0L2L5 | 1-68 | MQVHLSDWLVKHELVHRSLGFDCRGIEILQIKSEDWDSIAVISYVYGYNYLRSQCAYDVAPGGFLASV |
| A0A6C0SQA5 | 1-82 | MQVHLSDWLVKHELIHRSLGFDCRGIETLQIKIEDWDSIAVISYVYGYNYLRSQCAYDVAPGGFLASVYHLTKIRYGIDKPE |
| A0A5D2F1X1 | 22-80 | None |
| A0A453HBQ8 | 5-71 | None |
| A0A2U1Q398 | 154-220 | None |
| A0A7J6ENJ9 | 1-71 | None |
| A0A0D3D529 | 95-173 | None |
| A0A191T6J6 | 330-411 | None |
| A0A4D6NPI7 | 204-298 | None |
| A0A2G3AJI6 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.