DPCstruct | MC5118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 168 ± 25 aa |
| Standard deviation of domain lengths | 24.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5UX06 | 1-130 | MFHLLCTKKLLDRIKPEIAEPGQSDTALGNWYATVLFWKPQVALLVSERTLLPVLMPLAPAATLARRFPAHLALVLKEHGVPSEFVA… |
| A0A316TZD7 | 2-169 | LYLRCTKKLLKRMKGPDPLPEGDPGSSNKLGDWYAHVKPLTYKGKLVVIFLNQKTLLSVFVPGYGNRKVLPEFLARTEILLHNLEIP… |
| A0A1G3X127 | 1-134 | None |
| A0A3N0VL30 | 2-168 | None |
| A0A0R2K0V6 | 1-171 | None |
| A0A3C1DG50 | 2-215 | None |
| R9WKL4 | 1-167 | None |
| A0A072NQ24 | 1-170 | None |
| A0A7Y0KWJ8 | 3-164 | None |
| A0A2P8KLS8 | 3-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.