DPCstruct | MC51171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 4 aa |
| Standard deviation of domain lengths | 4.23 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1I1N5 | 1-140 | ATALTLRQARERNVDNFYFFCQHITLLPTLRSLLDQPDNSIDAFLAPGHVSMVIGTEAYGFIASDYHRPLVVAGFEPLDLLQGAVML… |
| K2ENK5 | 135-261 | TAWGIQQGLTVYSSHKVFLPAMQALLDMGEIKIDGFIDPGHVSTVTGIHPYEKLEIPQVITGFEMQDVLEGIVLLLNQIKNDDLTVV… |
| A0A6A9T187 | 292-432 | None |
| A0A4D4MK33 | 2-136 | None |
| A0A2G6FLM3 | 216-358 | None |
| A0A0J7KIL1 | 132-270 | None |
| A0A7C4GJW8 | 144-283 | None |
| A0A497DKY0 | 147-283 | None |
| A0A812UZY6 | 926-1064 | None |
| A0A0B0HCN0 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.