DPCstruct | MC5117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 91 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258KVD4 | 24-115 | MSVNDRIQALFRYCSENDRICPQPLRWQEFWRLIGEPSVLSVPLILSGWNFSTDREKRERFESHLRYAIEDGMLDNAERFLMTLGVD… |
| A0A316TSZ8 | 54-147 | IRRLLNYCAENGRVCPMPHKWKQLYELLPNTKRKLNGGFDPPAPLILSAWHHSSNFQKIMRLKEHIEWAVEQGSLETIAQYLYSLDE… |
| A0A5S4F7Q8 | 2-100 | None |
| A0A4Q3N106 | 368-458 | None |
| F5Y2K2 | 27-119 | None |
| A0A5S3VTZ7 | 2-89 | None |
| A0A537SJR0 | 4-86 | None |
| A0A2V8DFR4 | 2-94 | None |
| A0A6J4PHA2 | 65-158 | None |
| A0A399QYJ1 | 13-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.