DPCstruct | MC51165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 128 ± 22 aa |
| Standard deviation of domain lengths | 21.50 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 36.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1A030 | 4-111 | PTFMTNDLIVQHASAAGATEPVDKVSSRYTFVPTLDAVDLLRDAGWFPIKAEQSRTRIQDKEGFQKHCIRFTRNENLQMNIKDERVD… |
| A0A6M1HSC1 | 1-127 | DRPLTHEELMHYVPSIFGEDRHTSRSKRYAYIPTITVLESLQQEGFQPFFACQTRVRDPGRRGYTKHMLRLRRAGEINGEHVPEIIL… |
| M6JYU6 | 1-129 | None |
| A0A2E4HLC0 | 1-177 | None |
| H6SJP6 | 190-333 | None |
| A0A2E5G479 | 24-177 | None |
| A0A2R3Q4M4 | 47-191 | None |
| A0A827ILH1 | 2-143 | None |
| A0A2N3WNW7 | 91-239 | None |
| A0A3S0D6D4 | 20-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.