DPCstruct | MC51163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 145 ± 27 aa |
| Standard deviation of domain lengths | 26.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0Q1Q5 | 18-135 | GEFTRAKRGGGTDMANRFLDHGNYLAYGLAAVAAWVTGLPHGLAVLHGKTRRGGLVFDIADLIKDALVLPQAFIAAMAGDDEQEFRQ… |
| A0A4R3J4X7 | 3-108 | ADLPNQALNHAASAVEAAAAIAVCARATIPQLGFIHEDPGQSFAHDVADLYRDSITIPCAFRAAKHVTERPADNVERMTRRLTGTAL… |
| A0A1X7HGT1 | 13-184 | None |
| A0A4D0R088 | 5-122 | None |
| A0A497BFW7 | 133-296 | None |
| A0A1C4RKY9 | 386-556 | None |
| A0A3L8RFR1 | 143-318 | None |
| A0A133ZAJ8 | 1-171 | None |
| M5S0F7 | 3-116 | None |
| A0A839ZA65 | 43-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.