DPCstruct | MC51158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 332 ± 68 aa |
| Standard deviation of domain lengths | 68.44 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.07 |
| Pfam Score | 99.26 |
| Assigned Pfam label(s) | PF20149- CL0056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3L7U8 | 183-453 | AVLPNAGGLIASASALTAGVGLGGRGSKRLSNAHLEFTSQELLIWRKSFLPAALAYLAHSDHPWSIDDTTQLALWGFYRSFDLPPDP… |
| A0A164T445 | 2-220 | RQVTKTAWRIIRARVVTENAWPEHGKLQAFIQDAWTMANEIHNRNYHLTDNVGCSLGKRQTQVNSETIGKTRLAVVNAYKFDLSPTA… |
| V2WUT0 | 44-396 | None |
| M5G343 | 79-428 | None |
| A0A5B1QTQ4 | 219-636 | None |
| A0A0C3EPV2 | 72-378 | None |
| A0A166KVK0 | 28-495 | None |
| F8PM04 | 42-336 | None |
| A0A4Y9YGF3 | 364-760 | None |
| A0A401GZM4 | 196-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.