DPCstruct | MC51156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 7.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 67.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0114 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540MEM2 | 1-53 | MEEEIQRIKANNPDISHREAFSTAAKNWAHFPRIHFGLMLETNSQAKLDNICK |
| A0A6S7KXV7 | 63-114 | FIKEEIQRIKARNPDISHREAFSAAAKNWAHFPHIHFGLMGDQTTAVNKSSM |
| A0A1E5W7D6 | 27-76 | None |
| A0A833VNX7 | 191-245 | None |
| A0A4Y1QZT4 | 110-164 | None |
| A0A067GY42 | 80-145 | None |
| A0A5D2IFB3 | 130-186 | None |
| A0A498KBM0 | 203-268 | None |
| A0A059CQE3 | 45-110 | None |
| A0A438HBD6 | 31-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.