DPCstruct | MC51152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 198 ± 45 aa |
| Standard deviation of domain lengths | 44.62 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 70.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 99.26 |
| Assigned Pfam label(s) | PF03004- PF05056- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540M2P7 | 11-235 | KLLIDTKGKRVLFAEAGKDFVDFLLTILSLPLGTVIRLLSKDGMVGSLGKLYGSVESLSSTYMQPHFNKESLLKPKATATSDVGADV… |
| A0A2K3LU02 | 112-347 | VEENESKKLKIKVMLRKSNNKILFALGDADFADFILSLLTFPLGGVEHMLKGNSCDSSIDNFYKSIVELDSDTYLRSSDLKDKLVKS… |
| A0A1R3K6Q0 | 2-159 | None |
| A0A396GYQ2 | 162-373 | None |
| A0A022R1A1 | 42-224 | None |
| A0A022RB21 | 2-118 | None |
| A0A0D9UWW0 | 1-253 | None |
| A0A5N6PIP8 | 453-769 | None |
| A0A396GZ15 | 3-184 | None |
| A0A0E0PGP3 | 286-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.