DPCstruct | MC51151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 84 ± 15 aa |
| Standard deviation of domain lengths | 14.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540M2D5 | 68-152 | DTFKQWVKEMAAHVKSIDSQHLLEIGLEGFYRQTTPDKKQFNPGNQEYGSDFIASNLLPEIDFSTIHIYAEQWLSGSSEEAQDAF |
| A0A2I0A016 | 40-149 | TLQAWIEEMAGYVKSIDRNHLLEVGLEGFYGDSMEERKRFNPGYGVGSDFIANNLDPHIDFSTIHLYPDQWIPGSDVADQFAFLQAW… |
| A0A2I0IBX3 | 53-139 | None |
| A0A843X0D3 | 66-153 | None |
| A0A834SNJ9 | 169-282 | None |
| A0A1U8F0A0 | 1-63 | None |
| A0A2G3AZ89 | 1-63 | None |
| A0A2G3AZI8 | 112-177 | None |
| A0A7S3C8T0 | 169-248 | None |
| A0A4Y7IQG7 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.