DPCstruct | MC51150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 9 aa |
| Standard deviation of domain lengths | 8.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 54.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540M0A8 | 1-130 | MKDAASSITLEDVIRKHTVPSTHQSSSKNAVERSITMGKVEGSIEAVRTALRKLEEGCSAEDSEAVCAPEVVHQIYKWKNKLRVYLA… |
| A0A251UAT8 | 1-106 | MKEAASSVTLDEVKKYHQEKVPSTHALSSRVDKTIYLARVEGAVKAINLAAKKLKDGCSVEDVKAVCDPGVFDQLMRWKDRLGVYLA… |
| A0A6P5GU09 | 383-506 | None |
| A0A287WFJ7 | 150-273 | None |
| A0A453KJR3 | 1-134 | None |
| V4U4S2 | 238-346 | None |
| A0A5D2STS3 | 499-624 | None |
| A0A314ZNJ8 | 331-456 | None |
| A0A251VF52 | 572-682 | None |
| A0A438IL68 | 183-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.