DPCstruct | MC5115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 212 ± 37 aa |
| Standard deviation of domain lengths | 36.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8MTL8 | 5-205 | FKVLSPTAILGYGFPEESFRKAMAESPDLIAVDAGSSDPGPHYLGAGKPFTDRAGVKRDLRYMITAGVQNNIPVVIGTAGGSGAAPH… |
| A0A812PEP0 | 198-420 | RPVRIANCSGFFGDRLSGAEEMVEGGPIDVLTGDWLAELTMLILSRIRTKRPGGGFASTFVTQMDQVMGRCLDRGIKVVSNAGGLDP… |
| C4JTC8 | 4-190 | None |
| A0A084RZQ8 | 34-185 | None |
| A0A366RR19 | 17-214 | None |
| A0A7J6LTW1 | 20-213 | None |
| A0A100J341 | 2-214 | None |
| A0A7I4EMV2 | 18-264 | None |
| A0A2W6AVT5 | 3-224 | None |
| R1GU49 | 12-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.